PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00113602001
Common NameGSBRNA2T00113602001, LOC106377266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Dof
Protein Properties Length: 295aa    MW: 31554.5 Da    PI: 7.8596
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00113602001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.3e-3848108262
               zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                          ++++lkcprC+s ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s+
  GSBRNA2T00113602001  48 HHQSLKCPRCNSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKAKRSK 108
                          57899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-3239101IPR003851Zinc finger, Dof-type
PfamPF027015.3E-3350106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.53452106IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105490IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MQDIHDYSMT GGGGSGGSTG RFYGGGIGGG GGGGDRRMRT HQNNILNHHQ SLKCPRCNSL  60
NTKFCYYNNY NLSQPRHFCK NCRRYWTKGG VLRNVPVGGG CRKAKRSKSK QPQPSSPSSA  120
DKPTTQNVEE KSSSSESSSL TASNSTAVTV TATAAKVASP RVMDTDMPNL KQYGNGIEWS  180
TLLGQGSSDG GAFSEIGGFT AASMVETTPF RFGGTSVNHQ SIADHLKFED NTVQQQFGDP  240
TAQVDPNMGF EPLDWGSGGG DQTFFDLTSS VDHAYWSQSQ WASSDQDQNG LYLP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.79090.0flower
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00113602001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531381e-140AK353138.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-G03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013672917.10.0PREDICTED: dof zinc finger protein DOF5.4-like
SwissprotQ8LDR01e-131DOF54_ARATH; Dof zinc finger protein DOF5.4
TrEMBLA0A078ELV90.0A0A078ELV9_BRANA; BnaA03g39760D protein
STRINGBra013003.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44822656
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.11e-105OBF binding protein 4
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]